Rabbit anti-Human VPS39 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15624P

• Product Name:
• Rabbit anti-Human VPS39 Monoclonal Antibody

• Synonym:
• TLP; VAM6; hVam6p; VPS39

• Description:
• The antibody against VPS39 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 851-886 of human VPS39(NP_001288067.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 851-886 of human VPS39(NP_001288067.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• VPS39

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNPADT

• Gene ID:
• 23339

• Uniprot-ID:
• Q96JC1

• Positive Samples:
• Affinity purification