Rabbit anti-Human Vinculin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17123P

• Product Name:
• Rabbit anti-Human Vinculin Monoclonal Antibody

• Synonym:
• MV; MVCL; CMD1W; CMH15; HEL114; Vinculin

• Description:
• The antibody against Vinculin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Vinculin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM

• Gene ID:
• 7414

• Uniprot-ID:
• P18206

• Purification Method:
• HeLa, HepG2, RD, Mouse liver, Mouse brain, Rat liver, Rat skeletal muscle, Rat brain

• Positive Samples:
• Affinity purification