Rabbit anti-Human USP14 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16258P

• Product Name:
• Rabbit anti-Human USP14 Monoclonal Antibody

• Synonym:
• TGT; Ubp6; USP14

• Description:
• The antibody against USP14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 371-473 of human USP14 (P54578) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 371-473 of human USP14 (P54578).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• USP14

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWH

• Gene ID:
• 9097

• Uniprot-ID:
• P54578

• Purification Method:
• HeLa, HCT 116, U-251MG, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification