Rabbit anti-Human UCHL5IP Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14679P

• Product Name:
• Rabbit anti-Human UCHL5IP Monoclonal Antibody

• Synonym:
• UIP1; UCHL5IP

• Description:
• The antibody against UCHL5IP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-285 of human UCHL5IP (NP_001372411.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 150-285 of human UCHL5IP (NP_001372411.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• UCHL5IP

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQ

• Gene ID:
• 55559

• Uniprot-ID:
• Q99871

• Purification Method:
• HeLa

• Positive Samples:
• Affinity purification