Rabbit anti-Human UBE2C Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15564P

• Product Name:
• Rabbit anti-Human UBE2C Monoclonal Antibody

• Synonym:
• UBCH10; dJ447F3.2; UBE2C

• Description:
• The antibody against UBE2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human TLR4 (NP_008950.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human TLR4 (NP_008950.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• UBE2C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

• Gene ID:
• 11065

• Uniprot-ID:
• O00762

• Purification Method:
• MCF7, HeLa, NIH/3T3, Rat thymus

• Positive Samples:
• Affinity purification