Rabbit anti-Human UBA52 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15867P

• Product Name:
• Rabbit anti-Human UBA52 Monoclonal Antibody

• Synonym:
• L40; CEP52; RPL40; HUBCEP52; UBA52

• Description:
• The antibody against UBA52 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBA52 (P62987) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBA52 (P62987).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• UBA52

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCY

• Gene ID:
• 7311

• Uniprot-ID:
• P62987

• Purification Method:
• MCF7, PC-3, U-937, Mouse liver, Mouse testis, Mouse kidney, Rat liver, Rat testis

• Positive Samples:
• Affinity purification