Rabbit anti-Human U2AF2/U2AF65 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13879P

• Product Name:
• Rabbit anti-Human U2AF2/U2AF65 Monoclonal Antibody

• Synonym:
• U2AF65; U2AF2/U2AF65

• Description:
• The antibody against U2AF2/U2AF65 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 376-475 of human U2AF2/U2AF2/U2AF65 (P26368) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 376-475 of human U2AF2/U2AF2/U2AF65 (P26368).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• U2AF2/U2AF65

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

• Gene ID:
• 11338

• Uniprot-ID:
• P26368

• Purification Method:
• HeLa, HT-29, Mouse lung, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification