Rabbit anti-Human TWIST1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15698P

• Product Name:
• Rabbit anti-Human TWIST1 Monoclonal Antibody

• Synonym:
• TWIST1; ACS3; BPES2; BPES3; CRS; CRS1; CSO; SCS; TWIST; bHLHa38; twist-related protein 1

• Description:
• The antibody against TWIST1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TWIST1(NP_000465.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TWIST1(NP_000465.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TWIST1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLK

• Gene ID:
• 7291

• Uniprot-ID:
• Q15672

• Purification Method:
• SH-SY5Y

• Positive Samples:
• Affinity purification