Rabbit anti-Human Tropomyosin 1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13982P

• Product Name:
• Rabbit anti-Human Tropomyosin 1 Monoclonal Antibody

• Synonym:
• CMH3; TMSA; CMD1Y; LVNC9; C15orf13; HEL-S-265; HTM-alpha; Tropomyosin 1

• Description:
• The antibody against Tropomyosin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Tropomyosin 1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

• Gene ID:
• 7168

• Uniprot-ID:
• P09493

• Purification Method:
• Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart

• Positive Samples:
• Affinity purification