Rabbit anti-Human Transferrin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16768P

• Product Name:
• Rabbit anti-Human Transferrin Monoclonal Antibody

• Synonym:
• TFQTL1; PRO1557; PRO2086; HEL-S-71p; Transferrin

• Description:
• The antibody against Transferrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Transferrin (P02787) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Transferrin (P02787).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Transferrin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIP

• Gene ID:
• 7018

• Uniprot-ID:
• P02787

• Purification Method:
• Human serum

• Positive Samples:
• Affinity purification