Rabbit anti-Human TRβ1/THRB Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14948P

• Product Name:
• Rabbit anti-Human TRβ1/THRB Monoclonal Antibody

• Synonym:
• TRb; GRTH; PRTH; THR1; ERBA2; NR1A2; THRB1; THRB2; TRbeta; THRbeta; TRbeta1; C-ERBA-2; THRbeta1; Thrbeta2; C-ERBA-BETA; TRβ1/THRB

• Description:
• The antibody against TRβ1/THRB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human TRβ1/THRB (NP_000452.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human TRβ1/THRB (NP_000452.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TRβ1/THRB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEK

• Gene ID:
• 7068

• Uniprot-ID:
• P10828

• Purification Method:
• HepG2

• Positive Samples:
• Affinity purification