• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human TORC2 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-13290P
  • Product Name:
  • Rabbit anti-Human TORC2 Monoclonal Antibody
  • Synonym:
  • TORC2; TORC-2
  • Description:
  • The antibody against TORC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 594-693 of human TORC2 (Q53ET0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 594-693 of human TORC2 (Q53ET0).
  • Species Reactivity:
  • Human, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • TORC2
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • PQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
  • Gene ID:
  • 200186
  • Purification Method:
  • 293T, Rat liver
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human UFD1L Monoclonal Antibody-ADA-13287P
  • Online Inquiry

    refresh