Rabbit anti-Human TOR4A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13405P

• Product Name:
• Rabbit anti-Human TOR4A Monoclonal Antibody

• Synonym:
• C9orf167; TOR4A

• Description:
• The antibody against TOR4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TOR4A (Q9NXH8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TOR4A (Q9NXH8).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TOR4A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIV

• Gene ID:
• 54863

• Uniprot-ID:
• Q9NXH8

• Purification Method:
• K-562, A-549, Jurkat, mouse thymus

• Positive Samples:
• Affinity purification