Rabbit anti-Human TNFRSF14/HVEM Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15510P

• Product Name:
• Rabbit anti-Human TNFRSF14/HVEM Monoclonal Antibody

• Synonym:
• TNFRSF14; ATAR; CD270; HVEA; HVEM; LIGHTR; TR2; TNF receptor superfamily member 14; TNFRSF14/HVEM

• Description:
• The antibody against TNFRSF14/HVEM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-162 of human TNFRSF14/HVEM(NP_003811.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 39-162 of human TNFRSF14/HVEM(NP_003811.2)

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TNFRSF14/HVEM

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLC

• Gene ID:
• 8764

• Uniprot-ID:
• Q92956

• Positive Samples:
• Affinity purification