Rabbit anti-Human TMEFF2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14318P

• Product Name:
• Rabbit anti-Human TMEFF2 Monoclonal Antibody

• Synonym:
• TR; HPP1; TPEF; TR-2; TENB2; CT120.2; TMEFF2

• Description:
• The antibody against TMEFF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 275-374 of human TMEFF2 (Q9UIK5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 275-374 of human TMEFF2 (Q9UIK5).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TMEFF2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGHYSSDNTTRASTRLI

• Gene ID:
• 23671

• Uniprot-ID:
• Q9UIK5

• Purification Method:
• HeLa, PC-3, SH-SY5Y, Rat testis

• Positive Samples:
• Affinity purification