Rabbit anti-Human TLE1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13798P

• Product Name:
• Rabbit anti-Human TLE1 Monoclonal Antibody

• Synonym:
• ESG; ESG1; GRG1; TLE-1; TLE1

• Description:
• The antibody against TLE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human TLE1 (Q04724) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-250 of human TLE1 (Q04724).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TLE1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LQPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVV

• Gene ID:
• 7088

• Uniprot-ID:
• Q04724

• Purification Method:
• Mouse lung, Mouse brain, Rat lung, Rat liver, HepG2, U-87MG

• Positive Samples:
• Affinity purification