Rabbit anti-Human TIMP2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14476P

• Product Name:
• Rabbit anti-Human TIMP2 Monoclonal Antibody

• Synonym:
• DDC8; CSC-21K; TIMP2

• Description:
• The antibody against TIMP2 was raised in Rabbit using the recombinant protein of human TIMP2 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human TIMP2.

• Species Reactivity:
• Human, Mouse, Rat, African green monkey

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TIMP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS

• Gene ID:
• 7077

• Uniprot-ID:
• P16035

• Purification Method:
• SH-SY5Y, HT-1080, Rat brain, COS-7, Mouse testis, Mouse brain, Mouse lung

• Positive Samples:
• Affinity purification