Rabbit anti-Human TIMM17B Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15633P

• Product Name:
• Rabbit anti-Human TIMM17B Monoclonal Antibody

• Synonym:
• JM3; TIM17B; DXS9822; TIMM17B

• Description:
• The antibody against TIMM17B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 60-160 of human TIMM17B (NP_005825.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 60-160 of human TIMM17B (NP_005825.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TIMM17B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGT

• Gene ID:
• 10245

• Uniprot-ID:
• O60830

• Purification Method:
• 293T, Rat liver

• Positive Samples:
• Affinity purification