Rabbit anti-Human Thioredoxin 1 (Trx1/TXN) Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13822P

• Product Name:
• Rabbit anti-Human Thioredoxin 1 (Trx1/TXN) Monoclonal Antibody

• Synonym:
• TRX; TRDX; TRX1; Trx80; Thioredoxin 1 (Trx1/TXN)

• Description:
• The antibody against Thioredoxin 1 (Trx1/TXN) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 26-105 of human Thioredoxin 1 (Trx1/TXN) (P10599) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 26-105 of human Thioredoxin 1 (Trx1/TXN) (P10599).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Thioredoxin 1 (Trx1/TXN)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

• Gene ID:
• 7295

• Uniprot-ID:
• P10599

• Purification Method:
• HeLa, HepG2, MCF7, THP-1, Mouse lung, Mouse brain, Rat liver

• Positive Samples:
• Affinity purification