Rabbit anti-Human TET1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16394P

• Product Name:
• Rabbit anti-Human TET1 Monoclonal Antibody

• Synonym:
• LCX; CXXC6; bA119F7.1; TET1

• Description:
• The antibody against TET1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1800-1900 of human TET (NP_085128.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1800-1900 of human TET (NP_085128.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TET1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TLGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPAPLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPG

• Gene ID:
• 80312

• Uniprot-ID:
• Q8NFU7

• Purification Method:
• Hep G2, Mouse brain

• Positive Samples:
• Affinity purification