Rabbit anti-Human Tec Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14762P

• Product Name:
• Rabbit anti-Human Tec Monoclonal Antibody

• Synonym:
• PSCTK4; Tec

• Description:
• The antibody against Tec was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Tec (NP_003206.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Tec (NP_003206.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Tec

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGL

• Gene ID:
• 7006

• Uniprot-ID:
• P42680

• Purification Method:
• HepG2, Mouse liver, Mouse kidney, Rat liver, MCF7

• Positive Samples:
• Affinity purification