• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human TEAD1 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-13967P
  • Product Name:
  • Rabbit anti-Human TEAD1 Monoclonal Antibody
  • Synonym:
  • AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TEAD1
  • Description:
  • The antibody against TEAD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TEAD1 (P28347) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA, CUT&Tag.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TEAD1 (P28347).
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, IP, ChIP, ELISA, CUT&Tag
  • Storage Buffer:
  • PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • TEAD1
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR
  • Gene ID:
  • 7003
  • Purification Method:
  • HeLa, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human MAD1/MAD1L1 Monoclonal Antibody-ADA-13966P
  • Online Inquiry

    refresh