Rabbit anti-Human TCIRG1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16440P

• Product Name:
• Rabbit anti-Human TCIRG1 Monoclonal Antibody

• Synonym:
• a3; Stv1; Vph1; Atp6i; OC116; OPTB1; TIRC7; ATP6N1C; ATP6V0A3; OC-116kDa; TCIRG1

• Description:
• The antibody against TCIRG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to aminoacids 1-356 of human TCIRG1(NP_006010.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to aminoacids 1-356 of human TCIRG1(NP_006010.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TCIRG1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFHCHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMKAVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRD

• Gene ID:
• 10312

• Uniprot-ID:
• Q13488

• Purification Method:
• Mouse spleen

• Positive Samples:
• Affinity purification