Rabbit anti-Human TCF1/TCF7 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14487P

• Product Name:
• Rabbit anti-Human TCF1/TCF7 Monoclonal Antibody

• Synonym:
• TCF-1; TCF1/TCF7

• Description:
• The antibody against TCF1/TCF7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TCF1/TCF7 (NP_003193.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TCF1/TCF7 (NP_003193.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TCF1/TCF7

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKA

• Gene ID:
• 6932

• Uniprot-ID:
• P36402

• Purification Method:
• Jurkat, MOLT-4, Mouse thymus

• Positive Samples:
• Affinity purification