Rabbit anti-Human TAP2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15665P

• Product Name:
• Rabbit anti-Human TAP2 Monoclonal Antibody

• Synonym:
• APT2; PSF2; ABC18; ABCB3; PSF-2; RING11; D6S217E; TAP2

• Description:
• The antibody against TAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-686 of human TAP2 (NP_001276972.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 450-686 of human TAP2 (NP_001276972.1)

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TAP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL

• Gene ID:
• 6891

• Uniprot-ID:
• Q03519

• Purification Method:
• Raji

• Positive Samples:
• Affinity purification