Rabbit anti-Human TAP1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15038P

• Product Name:
• Rabbit anti-Human TAP1 Monoclonal Antibody

• Synonym:
• APT1; PSF1; ABC17; ABCB2; PSF-1; RING4; TAP1N; D6S114E; TAP1*0102N; TAP1

• Description:
• The antibody against TAP1 was raised in Rabbit using the recombinant funsion protein containing a sequence corresponding to amino acids 449-748 of human TAP1 (NP_000584.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant funsion protein containing a sequence corresponding to amino acids 449-748 of human TAP1 (NP_000584.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TAP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE

• Gene ID:
• 6890

• Uniprot-ID:
• Q03518

• Purification Method:
• A549, Mouse spleen, Mouse colon

• Positive Samples:
• Affinity purification