Rabbit anti-Human Survivin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13913P

• Product Name:
• Rabbit anti-Human Survivin Monoclonal Antibody

• Synonym:
• API4; EPR-1; Survivin

• Description:
• The antibody against Survivin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human Survivin (O15392) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human Survivin (O15392).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Survivin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAA

• Gene ID:
• 332

• Uniprot-ID:
• O15392

• Purification Method:
• Mouse spleen, Mouse thymus, Rat testis

• Positive Samples:
• Affinity purification