Rabbit anti-Human SUMO2/3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15024P

• Product Name:
• Rabbit anti-Human SUMO2/3 Monoclonal Antibody

• Synonym:
• HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2; SUMO2/3

• Description:
• The antibody against SUMO2/3 was raised in Rabbit using the recombinant protein of human SUMO2/3 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human SUMO2/3.

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SUMO2/3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

• Gene ID:
• 6613

• Uniprot-ID:
• P61956

• Purification Method:
• 293F, NIH/3T3, PC-12

• Positive Samples:
• Affinity purification