Rabbit anti-Human Stathmin 1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13852P

• Product Name:
• Rabbit anti-Human Stathmin 1 Monoclonal Antibody

• Synonym:
• Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215; Stathmin 1

• Description:
• The antibody against Stathmin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-149 of human Stathmin 1 (P16949) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Stathmin 1 (P16949).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Stathmin 1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

• Gene ID:
• 3925

• Uniprot-ID:
• P16949

• Purification Method:
• HeLa, Mouse testis, Mouse brain, Mouse thymus, Rat brain

• Positive Samples:
• Affinity purification