Rabbit anti-Human STAT6 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16874P

• Product Name:
• Rabbit anti-Human STAT6 Monoclonal Antibody

• Synonym:
• STAT6B; STAT6C; D12S1644; IL-4-STAT; STAT6

• Description:
• The antibody against STAT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 747-847 of human STAT6 (P42226-1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 747-847 of human STAT6 (P42226-1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• STAT6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• CQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW

• Gene ID:
• 6778

• Uniprot-ID:
• P42226

• Purification Method:
• TE-1, NIH/3T3, Mouse lung

• Positive Samples:
• Affinity purification