Rabbit anti-Human SOX11 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14722P

• Product Name:
• Rabbit anti-Human SOX11 Monoclonal Antibody

• Synonym:
• CSS9; MRD27; IDDMOH; SOX11

• Description:
• The antibody against SOX11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX11 (NP_003099.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX11 (NP_003099.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SOX11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIR

• Gene ID:
• 6664

• Uniprot-ID:
• P35716

• Purification Method:
• NIH/3T3, Y79, Neuro-2a, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification