Rabbit anti-Human Snail Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15585P

• Product Name:
• Rabbit anti-Human Snail Monoclonal Antibody

• Synonym:
• SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1; Snail

• Description:
• The antibody against Snail was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-157 of human Snail (NP_005976.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 80-157 of human Snail (NP_005976.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Snail

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCK

• Gene ID:
• 6615

• Uniprot-ID:
• O95863

• Purification Method:
• 293T transfected with Snail (Human)

• Positive Samples:
• Affinity purification