Rabbit anti-Human SMURF2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16898P

• Product Name:
• Rabbit anti-Human SMURF2 Monoclonal Antibody

• Synonym:
• SMURF2; E3 ubiquitin-protein ligase SMURF2

• Description:
• The antibody against SMURF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SMURF2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN

• Gene ID:
• 64750

• Uniprot-ID:
• Q9HAU4

• Purification Method:
• U2OS, MCF7, SH-SY5Y, Mouse lung, Mouse testis, Mouse brain

• Positive Samples:
• Affinity purification