• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human SMARCB1/SNF5 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-17208P
  • Product Name:
  • Rabbit anti-Human SMARCB1/SNF5 Monoclonal Antibody
  • Synonym:
  • RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144; F5
  • Description:
  • The antibody against SMARCB1/SNF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 275-375 of human SMARCB1/SNF5 (NP_003064.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 275-375 of human SMARCB1/SNF5 (NP_003064.2).
  • Species Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG
  • Application:
  • WB, IF/ICC, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • SMARCB1/SNF5
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • LVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRM
  • Gene ID:
  • 6598
  • Purification Method:
  • HeLa, K-562, 293T WT, Mouse spinal cord, Mouse brain
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human Smad3 Monoclonal Antibody-ADA-17207P
  • Online Inquiry

    refresh