Rabbit anti-Human Smad3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17278P

• Product Name:
• Rabbit anti-Human Smad3 Monoclonal Antibody

• Synonym:
• LDS3; mad3; LDS1C; MADH3; JV15-2; hMAD-3; hSMAD3; HSPC193; HsT17436; d3

• Description:
• The antibody against Smad3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Smad3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM

• Gene ID:
• 4088

• Uniprot-ID:
• P84022

• Purification Method:
• HCT116, A-549, C2C12, Rat testis

• Positive Samples:
• Affinity purification