Rabbit anti-Human Smad1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17206P

• Product Name:
• Rabbit anti-Human Smad1 Monoclonal Antibody

• Synonym:
• BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1; d1

• Description:
• The antibody against Smad1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-260 of human Smad1 (NP_001003688.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 160-260 of human Smad1 (NP_001003688.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Smad1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDV

• Gene ID:
• 4086

• Uniprot-ID:
• Q15797

• Purification Method:
• Hela, HUVEC

• Positive Samples:
• Affinity purification