Rabbit anti-Human Smac/Diablo Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13995P

• Product Name:
• Rabbit anti-Human Smac/Diablo Monoclonal Antibody

• Synonym:
• SMAC; DFNA64; Smac/Diablo

• Description:
• The antibody against Smac/Diablo was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 56-239 of human Smac/Diablo (NP_063940.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 56-239 of human Smac/Diablo (NP_063940.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Smac/Diablo

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

• Gene ID:
• 56616

• Uniprot-ID:
• Q9NR28

• Purification Method:
• SP2/0, HeLa, MCF7, C2C12, Jurkat, C6, Mouse heart, Rat lung, Rat testis

• Positive Samples:
• Affinity purification