Rabbit anti-Human SIRT5 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15105P

• Product Name:
• Rabbit anti-Human SIRT5 Monoclonal Antibody

• Synonym:
• SIR2L5; SIRT5

• Description:
• The antibody against SIRT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-310 of human SIRT5 (NP_036373.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 37-310 of human SIRT5 (NP_036373.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SIRT5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

• Gene ID:
• 23408

• Uniprot-ID:
• Q9NXA8

• Purification Method:
• 293F, Mouse heart, Mouse liver, Rat heart, Rat liver

• Positive Samples:
• Affinity purification