Rabbit anti-Human SFT Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13347P

• Product Name:
• Rabbit anti-Human SFT Monoclonal Antibody

• Synonym:
• SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1

• Description:
• The antibody against SFT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-147 of human SFT (NP_003329.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 50-147 of human SFT (NP_003329.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SFT

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

• Gene ID:
• 7321

• Uniprot-ID:
• P51668

• Positive Samples:
• Affinity purification