Rabbit anti-Human Sec61A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14270P

• Product Name:
• Rabbit anti-Human Sec61A Monoclonal Antibody

• Synonym:
• Sec61 alpha-2; SEC61A2; Sec61A

• Description:
• The antibody against Sec61A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Sec61A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLA

• Gene ID:
• 55176

• Uniprot-ID:
• Q9H9S3

• Purification Method:
• 293T, SH-SY5Y, Mouse lung, Mouse testis, Mouse brain, Rat testis

• Positive Samples:
• Affinity purification