Rabbit anti-Human S100A9 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16338P

• Product Name:
• Rabbit anti-Human S100A9 Monoclonal Antibody

• Synonym:
• MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387; S100-A9; S100A9

• Description:
• The antibody against S100A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human S100A9 (NP_002956.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human S100A9 (NP_002956.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• S100A9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

• Gene ID:
• 6280

• Uniprot-ID:
• P06702

• Purification Method:
• THP-1

• Positive Samples:
• Affinity purification