Rabbit anti-Human S100A11 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14950P

• Product Name:
• Rabbit anti-Human S100A11 Monoclonal Antibody

• Synonym:
• MLN70; S100C; HEL-S-43; S100A11

• Description:
• The antibody against S100A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• S100A11

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

• Gene ID:
• 6282

• Uniprot-ID:
• P31949

• Purification Method:
• MCF7, Jurkat(negative)

• Positive Samples:
• Affinity purification