Rabbit anti-Human S100/S100A1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13632P

• Product Name:
• Rabbit anti-Human S100/S100A1 Monoclonal Antibody

• Synonym:
• S100; S100A; S100-alpha; S100/S100A1

• Description:
• The antibody against S100/S100A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-94 of human S100/S100A1 (P23297) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 2-94 of human S100/S100A1 (P23297).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• S100/S100A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

• Gene ID:
• 6271

• Uniprot-ID:
• P23297

• Purification Method:
• Mouse lung, Mouse kidney, Mouse heart

• Positive Samples:
• Affinity purification