Rabbit anti-Human RSK2 / RPS6KA3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14511P

• Product Name:
• Rabbit anti-Human RSK2 / RPS6KA3 Monoclonal Antibody

• Synonym:
• CLS; RSK; HU-3; RSK2; MRX19; ISPK-1; XLID19; p90-RSK2; pp90RSK2; MAPKAPK1B; S6K-alpha3; RSK2 / RPS6KA3

• Description:
• The antibody against RSK2 / RPS6KA3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human RSK2 / RPS6KA3 (P51812) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 600-700 of human RSK2 / RPS6KA3 (P51812).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RSK2 / RPS6KA3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK

• Gene ID:
• 6197

• Uniprot-ID:
• P51812

• Purification Method:
• HeLa, HepG2, NIH/3T3

• Positive Samples:
• Affinity purification