Rabbit anti-Human RPL10A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15884P

• Product Name:
• Rabbit anti-Human RPL10A Monoclonal Antibody

• Synonym:
• uL1; L10A; CSA19; NEDD6; Csa-19; RPL10A

• Description:
• The antibody against RPL10A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human RPL10A (P62906) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human RPL10A (P62906).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RPL10A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMT

• Gene ID:
• 4736

• Uniprot-ID:
• P62906

• Purification Method:
• HepG2, Jurkat, U-87MG, Mouse spleen, Mouse thymus, Mouse uterus, Rat liver

• Positive Samples:
• Affinity purification