Rabbit anti-Human RNF8 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14933P

• Product Name:
• Rabbit anti-Human RNF8 Monoclonal Antibody

• Synonym:
• hRNF8; RNF8

• Description:
• The antibody against RNF8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RNF8 (NP_003949.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RNF8 (NP_003949.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RNF8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLK

• Gene ID:
• 9025

• Uniprot-ID:
• O76064

• Purification Method:
• 293T, Jurkat, HeLa, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification