Rabbit anti-Human RhoB Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14836P

• Product Name:
• Rabbit anti-Human RhoB Monoclonal Antibody

• Synonym:
• ARH6; ARHB; RHOH6; MST081; MSTP081; RhoB

• Description:
• The antibody against RhoB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoB (NP_004031.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoB (NP_004031.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RhoB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVR

• Gene ID:
• 388

• Uniprot-ID:
• P62745

• Purification Method:
• SK-BR-3, HeLa, Mouse brain, Mouse kidney, Rat brain, Rat lung

• Positive Samples:
• Affinity purification