Rabbit anti-Human RheB Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13803P

• Product Name:
• Rabbit anti-Human RheB Monoclonal Antibody

• Synonym:
• RHEB2; RheB

• Description:
• The antibody against RheB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RheB (Q15382) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RheB (Q15382).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RheB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH

• Gene ID:
• 6009

• Uniprot-ID:
• Q15382

• Positive Samples:
• Affinity purification