Rabbit anti-Human RGAP1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15615P

• Product Name:
• Rabbit anti-Human RGAP1 Monoclonal Antibody

• Synonym:
• CYK4; CDAN3B; ID-GAP; HsCYK-4; MgcRacGAP; [KD Validated] RGAP1

• Description:
• The antibody against RGAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 533-632 of human RGAP1 (NP_037409.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 533-632 of human RGAP1 (NP_037409.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RGAP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK

• Gene ID:
• 29127

• Uniprot-ID:
• Q9H0H5

• Purification Method:
• HeLa, T-47D, K-562, Mouse thymus, Mouse testis, Mouse heart, Rat testis

• Positive Samples:
• Affinity purification