Rabbit anti-Human Reptin/RUVBL2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13843P

• Product Name:
• Rabbit anti-Human Reptin/RUVBL2 Monoclonal Antibody

• Synonym:
• RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta; Reptin/RUVBL2

• Description:
• The antibody against Reptin/RUVBL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Reptin/RUVBL2 (Q9Y230) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Reptin/RUVBL2 (Q9Y230).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Reptin/RUVBL2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAF

• Gene ID:
• 10856

• Uniprot-ID:
• Q9Y230

• Purification Method:
• 293T, HepG2, Mouse testis, Mouse thymus

• Positive Samples:
• Affinity purification